PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538740.1_FGP017
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 1225aa    MW: 133441 Da    PI: 5.8619
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538740.1_FGP017genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.24.8e-21143230183
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                        f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++iyr++++r++lt+GW+ Fv a++Lk+gD+v+F 
  KN538740.1_FGP017 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFI 230
                        89*********************999*****9555555.49***********************************************7 PP

2Auxin_resp1171.5e-38303385183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        aahaas++s F+++YnPr+s+s Fv++v++++ka++++ svGmRf m+fete+ss+rr++Gtvvg+sd+dp+rWpnSkWr+L+
  KN538740.1_FGP017 303 AAHAASSGSSFTIYYNPRTSPSPFVIPVARYNKATYMQPSVGMRFAMMFETEESSKRRYTGTVVGISDYDPMRWPNSKWRNLQ 385
                        79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-38133234IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-34136231IPR015300DNA-binding pseudobarrel domain
CDDcd100174.14E-19142237No hitNo description
PfamPF023628.6E-19143230IPR003340B3 DNA binding domain
PROSITE profilePS5086310.8143242IPR003340B3 DNA binding domain
SMARTSM010192.3E-15143248IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-34266290IPR015300DNA-binding pseudobarrel domain
PfamPF065076.6E-34303385IPR010525Auxin response factor
PfamPF023091.1E-9841970IPR033389AUX/IAA domain
SuperFamilySSF542779.16E-9881965No hitNo description
PROSITE profilePS5174525.501886970IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1225 aa     Download sequence    Send to blast
MASSQEKAKT GVLRNAAALL DEMQLMGETQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTRKIPNSR IPNYPNLPSQ LLCQVHNITL HADKDTDEVY AQMTLQPVNS  120
ETDVFPIPTL GAYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NMWTFRHIYR GQPKRHLLTT GWSLFVGAKR LKAGDSVLFI SSNVNMTAIG  240
HHTFYSLGLT TAYEMPFLTE VPDCRDEKSQ LLLGVRRATR QQTMLSSSVL STDSMHIGVL  300
AAAAHAASSG SSFTIYYNPR TSPSPFVIPV ARYNKATYMQ PSVGMRFAMM FETEESSKRR  360
YTGTVVGISD YDPMRWPNSK WRNLQVEWDE HGYGERPERV SIWDIETPEN TLVFPSSTLN  420
SKRQCLPGYG VSVPGMELGS ANMSSFPRAQ GNPYGSLQHI PAVGSELAIM LLNQSGQTLG  480
SPLSFHQSSY SSIIQNAKQN FIPPLTVSTS ACLTKQESMP SDDAQHQFHM ANMQNGDLEG  540
SEVQPVIDSI SESKLNATSR DPRNTDSYTS RSTSEQNSKG EPRGKTRKSK KGLPHKTVSE  600
KSDLSSAPSW ICDNQQVGLE SKLVGCDEQV NCGNIEDSSG ALTQGNFVGQ PRGHQVEQKG  660
VLSPPKVESS KSPDEGKSVN SFPNQGCFSQ FIDGLDWMTQ PSYYQDSNVI QPAGVPENIF  720
SSSVDIPPSM IADTMETFQA SCLSDCLPNS IQEFISSPDL NSLTFLSPDM QNLEVQLQHD  780
GSNLPSTSNS FVQMSFSEES ASQSANLSGL HMESTHRSIN TTSCSQPMST GGFDAGMYSK  840
LPRLKESQIL SLPEIHTNSM GTSACSMDAT EYSLDRSTKP MKPPVRTYTK VQKQGSVGRS  900
IDVTGFRNYH ELRSAIACMF GLQGKLEHPG SSEWKLVYVD YENDVLLVGD DPWEEFINCV  960
RCIRILSPSE NDIYDLEKSE TTSKLPGGRG GARKDGRDPS LETAAEGGGA AALAVVDEVC  1020
VESRTVGGDG TIGSGRAREL ADAGGEKVGE GGDGTIGGGR ARELADAGGE KVGEGENPGN  1080
DELEQLSHTV DELVGESSRS GGGVGGDEVG GAETFVEGGD KEGERAAPRR RRVGADVASR  1140
VCGGADEERV PLPRRAEVAA AGEIIVGDVL VIGVEWRKTK VGDEEPSRGL AMLRRRRQGE  1200
CTPSFARVLR RKGRTVPRRF GRNWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.014105392Auxin response factor 5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
112081214LRRKGRT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712920.0AB071292.1 Oryza sativa OsMP mRNA for Arabidopsis Monopteros-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634367.10.0PREDICTED: auxin response factor 11-like
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLI1PQL70.0I1PQL7_ORYGL; Auxin response factor
STRINGLOC_Os04g56850.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0248600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86733241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein